DARPP - 32 : Regulator of the Efficacy of Dopaminergic Neurotransmission
نویسندگان
چکیده
Immunol. 157, 207 (1996). 10. D. L. DiGiusto and E. Palmer, Mol. Immunol. 31, 693 (1994). 11. The a wild-type, b wild-type, aIII, and bIII constructs have been previously described (8). The a wild-type amino acid sequence from the interchain Cys to the COOH-terminus is CDATLTEKSFETDMNLNFQNLSVMGLRILLLKVAGFNLLMTLRLWSS (30), with the a-CPM indicated in bold. The b wild-type amino acid sequence from the interchain Cys to the COOH-terminus is CGITSASYQQGVLSATILYEILLGKATLYAVLVSTLVVMAM VKRKNS. Similarly, the corresponding aIII amino acid sequence is CDATLTEKSFETVTVHTEKVNMMSLTVLGLRLLFAKTIAINFLLTVKLFF. The underlined sequences are derived from murine Cd and consequently, the distal five amino acids (DMNLN) of the a-CPM have been replaced. To permit surface expression of this chimeric a-chain, the aIII construct was paired with the bIII cDNA (8), which encodes the corresponding amino acid sequence CGITSASYQQGVLSATILYLLLLLKSVIYLAIISFSLLRRTSVCGNEKKS. The underlined sequences are derived from murine Cg1. Although this TCR is encoded by chimeric a and b chains, the functional defects associated with the aIII/bIII TCR are due to the absence of an intact a-CPM (8). cDNAs were excised with Eco RI and Bam and individually cloned into the Sal I and Bam sites of the expression vector pHSE39 (31). 12. B. Hausmann and E. Palmer, data not shown. 13. P. Borgulya, H. Kishi, Y. Uematsu, H. von Boehmer, Cell 69, 529 (1992). 14. In contrast to irradiated B6 mice, irradiated B6 athymic nude mice reconstituted with T cell–depleted bone marrow from a-CPM mutant animals failed to generate significant numbers of transgenic T cells. Therefore, the appearance of mutant T cells in the periphery is dependent on the presence of a thymus (12). 15. H. Suzuki, J. A. Punt, L. G. Granger, A. Singer, Immunity 2, 413 (1995). 16. W. Swat, L. Ignatowicz, H. von Boehmer, P. Kisielow, Nature 351, 150 (1991). 17. J. A. Punt, B. A. Osborne, Y. Takahama, S. O. Sharrow, A. Singer, J. Exp. Med. 179, 709 (1994). 18. D. M. Page, L. P. Kane, J. P. Allison, S. M. Hedrick, J. Immunol. 151, 1868 (1993). 19. S. J. Curnow, M. Barad, N. Brun-Roubereau, A. M. Schmitt-Verhulst, Cytometry 16, 41 (1994). 20. B. T. Bäckström and E. Palmer, unpublished observations. 21. V. P. Dave et al., EMBO J. 16, 1360 (1997). 22. M. Cohn and R. Langman, Behring Inst. Mitt. 70, 219 (1982). 23. K. A. Swan et al., EMBO J. 14, 276 (1995). 24. J. Alberola-Ila, K. A. Hogquist, K. A. Swan, M. J. Bevan, R. M. Perlmutter, J. Exp. Med. 184, 9 (1996). 25. C. C. O’Shea, T. Crompton, I. R. Rosewell, A. C. Hayday, M. J. Owen, Eur. J. Immunol. 26, 2350 (1996). 26. R. Amakawa et al., Cell 84, 551 (1996). 27. I. Correa et al., Proc. Natl. Acad. Sci. U.S.A. 89, 653 (1992). 28. M. Bigby et al., J. Immunol. 151, 4465 (1993). 29. E. Schweighoffer and B. J. Fowlkes, J. Exp. Med. 183, 2033 (1996). 30. Single-letter abbreviations for the amino acid residues are as follows: A, Ala; C, Cys; D, Asp; E, Glu; F, Phe; G, Gly; H, His; I, Ile; K, Lys; L, Leu; M, Met; N, Asn; P, Pro; Q, Gln; R, Arg; S, Ser; T, Thr; V, Val; W, Trp; and Y, Tyr. 31. H. Pircher et al., EMBO J. 8, 719 (1989). 32. M. M. Rozdzial, R. T. Kubo, S. L. Turner, T. H. Finkel, J. Immunol. 153, 1563 (1994). 33. T. Shiohara et al., ibid. 138, 1979 (1987). 34. The monoclonal antibodies (mAbs) to Va2.1 (B20.1), Vb8 (MR5-2), CD3« (145-2c11), CD4 (H129.19), and CD8 (53-6.7) were purchased from PharMingen (San Diego, CA). The z chain mAb H146-968 (32) and the I-Abm12 mAb 3JP (33) were purified from culture supernatants using protein G Sepharose beads (Pharmacia). Cells were analyzed on a FACScan or a FACStar Plus (Becton Dickinson) using the CellQuest software (Becton Dickinson). 35. B. T. Bäckström, B. Rubin, A. Peter, G. Tiefenthaler, E. Palmer, Eur. J. Immunol. 27, 1433 (1997). 36. The stimulation of DP thymocytes and Hoechst staining to detect apoptotic cells was carried out as previously described (16–19). Briefly, stimulator splenocytes were prepared from B6 (I-Ab) or B6.C.H2-bm12 (I-Abm12) mice. We cultured 2 3 106 stimulators (in 2 ml) for 12 to 16 hours in the presence or absence of titrated amounts of the I-Abm12 blocking mAb 3JP (34) in 24-well plates with 1 3 106 thymocytes from B6.Rag-2–/– mice expressing the wild-type or the a-CPM mutant TCR. Cells were then harvested and stained with Hoechst 33342 (1 mg/ml) followed by staining with CD4 mAb, CD8 mAb, and propidium iodide (2.5 mg/ml) and analyzed by flow cytometry. 37. We thank A. Peter and S. Stotz for generating the aIII and bIII constructs; J. Bluestone, L. Bolliger, R. Langman, and M. Cohn for discussions; S. Bahram, C. T. Baldari, T. Hünig, J. Howard, H. Jacobs, R. Leibnitz, M. Record, A. Rolink, C. Steinberg, S. Stotz, and R. Torres for comments; M. Dessing for flow cytometric analysis; and E. Wagner, W. Metzger, U. Schneider, E. Singer, and W. Hänggi for animal husbandry. Rag-2–/– (F. Alt) and B6.Rag-2–/– (A. Rolink) mice and the pHSE39 (H. Pircher) vector are gratefully acknowledged. Care of animals was carried out in accordance with the cantonal and federal laws of Switzerland. The Basel Institute for Immunology was founded and is supported by F. Hoffmann–La Roche Ltd., Basel, Switzerland.
منابع مشابه
DARPP-32: regulator of the efficacy of dopaminergic neurotransmission.
Dopaminergic neurons exert a major modulatory effect on the forebrain. Dopamine and adenosine 3',5'-monophosphate-regulated phosphoprotein (32 kilodaltons) (DARPP-32), which is enriched in all neurons that receive a dopaminergic input, is converted in response to dopamine into a potent protein phosphatase inhibitor. Mice generated to contain a targeted disruption of the DARPP-32 gene showed pro...
متن کاملDARPP-32 mediates serotonergic neurotransmission in the forebrain.
Serotonin is implicated in the regulation of complex sensory, motor, affective, and cognitive functions. However, the biochemical mechanisms whereby this neurotransmitter exerts its actions remain largely unknown. DARPP-32 (dopamine- and cAMP-regulated phosphoprotein of molecular weight 32,000) is a phosphoprotein that has primarily been characterized in relation to dopaminergic neurotransmissi...
متن کاملBeyond the Dopamine Receptor: Regulation and Roles of Serine/Threonine Protein Phosphatases
Dopamine plays an important modulatory role in the central nervous system, helping to control critical aspects of motor function and reward learning. Alteration in normal dopaminergic neurotransmission underlies multiple neurological diseases including schizophrenia, Huntington's disease, and Parkinson's disease. Modulation of dopamine-regulated signaling pathways is also important in the addic...
متن کاملDistinct roles of PDE4 and PDE10A in the regulation of cAMP/PKA signaling in the striatum.
Phosphodiesterase (PDE) is a critical regulator of cAMP/protein kinase A (PKA) signaling in cells. Multiple PDEs with different substrate specificities and subcellular localization are expressed in neurons. Dopamine plays a central role in the regulation of motor and cognitive functions. The effect of dopamine is largely mediated through the cAMP/PKA signaling cascade, and therefore controlled ...
متن کاملNo evidence for genetic association between DARPP-32 (PP1R1B) polymorphisms and attention deficit hyperactivity disorder.
Attention deficit hyperactivity disorder (ADHD) has a strong genetic basis, and evidence from human and animal studies suggests that a dopamine system dysfunction plays a role in the disorder pathophysiology. Several genes involved in dopamine neurotransmission have shown replicated genetic association with ADHD. These include the dopamine receptors D4 (DRD4), D5 (DRD5), and the dopamine transp...
متن کاملAmplification of dopaminergic signaling by a positive feedback loop.
Dopamine and cAMP-regulated phosphoprotein of M(r) 32,000 (DARPP-32) plays an obligatory role in most of the actions of dopamine. In resting neostriatal slices, cyclin-dependent kinase 5 (Cdk5) phosphorylates DARPP-32 at Thr-75, thereby reducing the efficacy of dopaminergic signaling. We report here that dopamine, in slices, and acute cocaine, in whole animals, decreases the state of phosphoryl...
متن کاملذخیره در منابع من
با ذخیره ی این منبع در منابع من، دسترسی به آن را برای استفاده های بعدی آسان تر کنید
عنوان ژورنال:
دوره شماره
صفحات -
تاریخ انتشار 1998